Glutamine synthetase/GLUL, Human (His)
GLUL proteins catalyze the conversion of glutamate and ammonia to glutamine. Glutamine synthetase/GLUL Protein, Human (His) is the recombinant human-derived Glutamine synthetase/GLUL protein, expressed by E. coli , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
Glutamine synthetase/GLUL Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/glutamine-synthetase-glul-protein-human-his.html
Purity
98.0
Smiles
TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Molecular Formula
2752 (Gene_ID) P15104 (T2-N373) (Accession)
Molecular Weight
40-50 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880029-500 1x 500 µL
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400040-100 1x 100 µL
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040012-100 1x 100 µL
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040525-500 1x 500 µL
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742848-500 1x 500 µL
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details