Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glutamine synthetase/GLUL, Human (His)

GLUL proteins catalyze the conversion of glutamate and ammonia to glutamine. Glutamine synthetase/GLUL Protein, Human (His) is the recombinant human-derived Glutamine synthetase/GLUL protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Glutamine synthetase/GLUL Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glutamine-synthetase-glul-protein-human-his.html

Purity

98.0

Smiles

TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

Molecular Formula

2752 (Gene_ID) P15104 (T2-N373) (Accession)

Molecular Weight

40-50 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3) Antibody
abx172773-01 200 µg

Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3) Antibody

Sign In for Pricing
View Details
Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3) Antibody
abx172773-02 1 mg

Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3) Antibody

Sign In for Pricing
View Details
Container, 60ml, 65x38mm, polystyrene, red screw cap, STERILE, 750 pieces per CAR
206162 750 pieces per CAR

Container, 60ml, 65x38mm, polystyrene, red screw cap, STERILE, 750 pieces per CAR

Sign In for Pricing
View Details
Isoc1 (NM_025478) Mouse Tagged Lenti ORF Clone
MR204116L3 10 µg

Isoc1 (NM_025478) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Nucleic Acid Lateral Flow (NALF) Barcode Test Strips, 50pk
AU2065-01 Probe 1

Nucleic Acid Lateral Flow (NALF) Barcode Test Strips, 50pk

Sign In for Pricing
View Details
CD51 (Integrin alphaV, Vitronectin alpha Subunit Receptor, VNR)
MBS6507188-01 0.1 mL

CD51 (Integrin alphaV, Vitronectin alpha Subunit Receptor, VNR)

Sign In for Pricing
View Details