Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Human (CHO)

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Human (CHO) is a recombinant human IL-17A protein and is expressed in CHO cells. It consists of 155 amino acids (M1-A155) .

Product Specifications

Product Name Alternative

IL-17A Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-human-cho.html

Purity

90.10

Smiles

MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Molecular Formula

3605 (Gene_ID) Q16552 (G24-A155) (Accession)

Molecular Weight

Approximately 32 kDa, based on SEC-MALS under reducing conditions, due to the glycosylation.

References & Citations

[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.|[5]Kinoshita H, et al. Cytokine milieu modulates release of thymic stromal lymphopoietin from human keratinocytes stimulated with double-stranded RNA. J Allergy Clin Immunol. 2009 Jan;123 (1) :179-86.|[6]Henness S, et al. IL-17A acts via p38 MAPK to increase stability of TNF-alpha-induced IL-8 mRNA in human ASM. Am J Physiol Lung Cell Mol Physiol. 2006 Jun;290 (6) :L1283-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp366 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4219605 3x 1.0 µg

Zfp366 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Chicken Tumor Necrosis Factor Receptor Superfamily, Member 1A ELISA kit
GTR10409814 96 Well

Chicken Tumor Necrosis Factor Receptor Superfamily, Member 1A ELISA kit

Sign In for Pricing
View Details
IFIH1 Recombinant Antibody, RBITC Conjugated
bsm-61660R-RBITC-TR 20 µL

IFIH1 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
[[4- (2-Butenylidene) -3,5,5-trimethyl-2-cyclohexen-1-yl]sulfinyl]-benzene
428555-01 500 µg

[[4- (2-Butenylidene) -3,5,5-trimethyl-2-cyclohexen-1-yl]sulfinyl]-benzene

Sign In for Pricing
View Details
[[4- (2-Butenylidene) -3,5,5-trimethyl-2-cyclohexen-1-yl]sulfinyl]-benzene
428555-02 1 mg

[[4- (2-Butenylidene) -3,5,5-trimethyl-2-cyclohexen-1-yl]sulfinyl]-benzene

Sign In for Pricing
View Details
Human IBSP knockdown cell line
ABC-KD7116 1 Vial

Human IBSP knockdown cell line

Sign In for Pricing
View Details