S100B, Human (HEK293, Fc)
S100B protein is encoded by the S100B gene and is a member of the S100 family. It regulates cellular processes such as cell cycle progression and differentiation. S100B Protein, Human (HEK293, Fc) is the recombinant human-derived S100B protein, expressed by HEK293 , with N-hFc labeled tag.
Product Specifications
Product Name Alternative
S100B Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/s100b-protein-human-hek293-fc.html
Purity
95.96
Smiles
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Molecular Formula
6285 (Gene_ID) NP_006263.1 (S2-E92) (Accession)
Molecular Weight
Approximately 35-40 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880146-100 1x 100 µL
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471081-100 1x 100 µL
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 