Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100B, Human (HEK293, Fc)

S100B protein is encoded by the S100B gene and is a member of the S100 family. It regulates cellular processes such as cell cycle progression and differentiation. S100B Protein, Human (HEK293, Fc) is the recombinant human-derived S100B protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

S100B Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100b-protein-human-hek293-fc.html

Purity

95.96

Smiles

SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Molecular Formula

6285 (Gene_ID) NP_006263.1 (S2-E92) (Accession)

Molecular Weight

Approximately 35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-11a Lentiviral Activation Particles (m2)
sc-420246-LAC-2 200 µL

Bcl-11a Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Anti-Human XCR1 Antibody (2H6), APC
HW728137-01 1 Each

Anti-Human XCR1 Antibody (2H6), APC

Sign In for Pricing
View Details
Anti-Human XCR1 Antibody (2H6), APC
HW728137-02 100 Tests

Anti-Human XCR1 Antibody (2H6), APC

Sign In for Pricing
View Details
UDP-3-O-Acyl-N-Acetylglucosamine Deacetylase (LPXC) Antibody (Biotin)
abx106306-01 20 µg

UDP-3-O-Acyl-N-Acetylglucosamine Deacetylase (LPXC) Antibody (Biotin)

Sign In for Pricing
View Details
UDP-3-O-Acyl-N-Acetylglucosamine Deacetylase (LPXC) Antibody (Biotin)
abx106306-02 50 µg

UDP-3-O-Acyl-N-Acetylglucosamine Deacetylase (LPXC) Antibody (Biotin)

Sign In for Pricing
View Details
UDP-3-O-Acyl-N-Acetylglucosamine Deacetylase (LPXC) Antibody (Biotin)
abx106306-03 100 µg

UDP-3-O-Acyl-N-Acetylglucosamine Deacetylase (LPXC) Antibody (Biotin)

Sign In for Pricing
View Details