Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIN/DYNLL1, Human (His)

PIN/DYNLL1 acts as a non-catalytic accessory component in the cytoplasmic dynein 1 complex, connecting dynein to cargos and adapter proteins for dynein modulation. It functions as a motor for retrograde vesicle movement along microtubules, potentially influencing cytoskeletal structure. PIN/DYNLL1 enhances ESR1 transactivation and aids ESR1 nuclear localization. PIN/DYNLL1 Protein, Human (His) is the recombinant human-derived PIN/DYNLL1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PIN/DYNLL1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pin-dynll1-protein-human-his.html

Purity

98.00

Smiles

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Molecular Formula

8655 (Gene_ID) P63167 (M1-G89) (Accession)

Molecular Weight

Approximately 14.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLA2R1 Recombinant Protein Antigen
NBP1-84449PEP 0.1 mL

PLA2R1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Zebrafish G6PD Rabbit Polyclonal Antibody (HRP)
orb3091418 100 µg

Zebrafish G6PD Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
OR2T11 antibody
70R-31473 0.1 mg

OR2T11 antibody

Sign In for Pricing
View Details
Lentiviral human NPHP3 shRNA (UAS) - Lentiviral human NPHP3 shRNA (UAS, iRFP) (100)
GTR15139287 1 Vial

Lentiviral human NPHP3 shRNA (UAS) - Lentiviral human NPHP3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
MFN1 Rabbit Polyclonal Antibody (Biotin)
orb2101201 100 µL

MFN1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
DCB
M27621-01 1 g

DCB

Sign In for Pricing
View Details