Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIN/DYNLL1, Human (His)

PIN/DYNLL1 acts as a non-catalytic accessory component in the cytoplasmic dynein 1 complex, connecting dynein to cargos and adapter proteins for dynein modulation. It functions as a motor for retrograde vesicle movement along microtubules, potentially influencing cytoskeletal structure. PIN/DYNLL1 enhances ESR1 transactivation and aids ESR1 nuclear localization. PIN/DYNLL1 Protein, Human (His) is the recombinant human-derived PIN/DYNLL1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PIN/DYNLL1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pin-dynll1-protein-human-his.html

Purity

98.00

Smiles

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Molecular Formula

8655 (Gene_ID) P63167 (M1-G89) (Accession)

Molecular Weight

Approximately 14.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kindlin-1 (D1K4C) Rabbit Monoclonal Antibody
CST 36734S 100 µL

Kindlin-1 (D1K4C) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Fish Ubiquilin 2 ELISA Kit
MBS055656 Inquire

Fish Ubiquilin 2 ELISA Kit

Sign In for Pricing
View Details
Islet-1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-62842R-BF647-TR 20 µL

Islet-1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
AIRE Antibody
orb1258616 100 µL

AIRE Antibody

Sign In for Pricing
View Details
CYP2C8 Rabbit Polyclonal Antibody
APRab09654-01 20 µL

CYP2C8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CYP2C8 Rabbit Polyclonal Antibody
APRab09654-02 50 µL

CYP2C8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details