PIN/DYNLL1, Human (His)
PIN/DYNLL1 acts as a non-catalytic accessory component in the cytoplasmic dynein 1 complex, connecting dynein to cargos and adapter proteins for dynein modulation. It functions as a motor for retrograde vesicle movement along microtubules, potentially influencing cytoskeletal structure. PIN/DYNLL1 enhances ESR1 transactivation and aids ESR1 nuclear localization. PIN/DYNLL1 Protein, Human (His) is the recombinant human-derived PIN/DYNLL1 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
PIN/DYNLL1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pin-dynll1-protein-human-his.html
Purity
98.00
Smiles
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Molecular Formula
8655 (Gene_ID) P63167 (M1-G89) (Accession)
Molecular Weight
Approximately 14.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
EPHA2 (Ephrin Type-A Receptor 2, Epithelial Cell Kinase, Tyrosine-protein Kinase Receptor ECK, ECK) (MaxLight 405)
EPHA2 (Ephrin Type-A Receptor 2, Epithelial Cell Kinase, Tyrosine-protein Kinase Receptor ECK, ECK) (MaxLight 405)
DDX28 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
