Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cysteine and glycine-rich protein 2 (CSRP2)

Product Specifications

Product Name Alternative

Cysteine-rich protein 2 ; CRP2LIM domain only protein 5 ; LMO-5Smooth muscle cell LIM protein ; SmLIM

Abbreviation

Recombinant Human CSRP2 protein

Gene Name

CSRP2

UniProt

Q16527

Expression Region

1-193aa

Organism

Homo sapiens (Human)

Target Sequence

MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major allergen Equ c 1, Recombinant, Equine, aa16-187, His-Tag
370683-01 20 µg

Major allergen Equ c 1, Recombinant, Equine, aa16-187, His-Tag

Sign In for Pricing
View Details
Major allergen Equ c 1, Recombinant, Equine, aa16-187, His-Tag
370683-02 100 µg

Major allergen Equ c 1, Recombinant, Equine, aa16-187, His-Tag

Sign In for Pricing
View Details
Phospho-CPI17alpha (Thr38) BioAssayTM ELISA Kit
472959 2x 96 Tests

Phospho-CPI17alpha (Thr38) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
Angiotensin-converting enzyme (ACE) Antibody (Biotin)
abx341174-01 50 µL

Angiotensin-converting enzyme (ACE) Antibody (Biotin)

Sign In for Pricing
View Details
Angiotensin-converting enzyme (ACE) Antibody (Biotin)
abx341174-02 100 µL

Angiotensin-converting enzyme (ACE) Antibody (Biotin)

Sign In for Pricing
View Details
Angiotensin-converting enzyme (ACE) Antibody (Biotin)
abx341174-03 200 µL

Angiotensin-converting enzyme (ACE) Antibody (Biotin)

Sign In for Pricing
View Details