Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CD70, Human (His)

As a ligand of CD27, CD70 protein is an indispensable part of T cell immune coordination and is of particular importance in antiviral responses. The CD70-CD27 pathway emerged as a key player that contributes to the generation and maintenance of T cell-mediated immune responses. Animal-Free CD70 Protein, Human (His) is the recombinant human-derived animal-FreeCD70 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CD70 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-cd70-protein-human-his.html

Purity

98.0

Smiles

QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Molecular Formula

970 (Gene_ID) P32970-1 (Q39-P193) (Accession)

Molecular Weight

Approximately 18.08 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mical2 (NM_177282) Mouse Tagged ORF Clone Lentiviral Particle
MR222755L4V 200 µL

Mical2 (NM_177282) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ANKRD11 CRISPR Activation Plasmid (h)
sc-404493-ACT 20 µg

ANKRD11 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Bropirimine
B7646-10 10 mg

Bropirimine

Sign In for Pricing
View Details
OSTF1 antibody
70R-19065 50 μL

OSTF1 antibody

Sign In for Pricing
View Details
cDNA - Dog Normal Tissue: Heart
C1734122 40 Reactions

cDNA - Dog Normal Tissue: Heart

Sign In for Pricing
View Details
PRKD3 Rabbit Polyclonal Antibody
MBS9466152-01 0.05 mL

PRKD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details