Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 4-like protein (CCL4L1) (Active)

Product Specifications

Product Name Alternative

G-26 T-lymphocyte-secreted protein, Lymphocyte activation gene 1 protein, LAG-1, MIP-1-beta1-69

Abbreviation

Recombinant Human CCL4 protein (Active)

Gene Name

CCL4

UniProt

Q8NHW4

Expression Region

24-92aa

Organism

Homo sapiens (Human)

Target Sequence

APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV) . The processed form MIP-1-beta (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta (3-69) is also a ligand for CCR1 and CCR2 isoform B. {ECO:0000269|PubMed:10540332, ECO:0000269|PubMed:12070155, ECO:0000269|PubMed:8525373}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human CCR5 transfected murine BaF3 cells is less than 2.0 ng/ml, corresponding to a specific activity of > 5.0 x 105 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV) . The processed form MIP-1-beta (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta (3-69) is also a ligand for CCR1 and CCR2 isoform B.

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Acetylcholine Receptor Antibody (Anti-AChR) BioAssayTM ELISA Kit (Human) (Discontiued) discontinued
023454-01 48 Tests

Anti-Acetylcholine Receptor Antibody (Anti-AChR) BioAssayTM ELISA Kit (Human) (Discontiued) discontinued

Sign In for Pricing
View Details
Anti-Acetylcholine Receptor Antibody (Anti-AChR) BioAssayTM ELISA Kit (Human) (Discontiued) discontinued
023454-02 96 Tests

Anti-Acetylcholine Receptor Antibody (Anti-AChR) BioAssayTM ELISA Kit (Human) (Discontiued) discontinued

Sign In for Pricing
View Details
OXGR1 (NM_080818) Human Untagged Clone
SC120362 10 µg

OXGR1 (NM_080818) Human Untagged Clone

Sign In for Pricing
View Details
SORL1 Antibody
MBS851715-01 0.1 mg

SORL1 Antibody

Sign In for Pricing
View Details
SORL1 Antibody
MBS851715-02 0.1 mL (AF405L)

SORL1 Antibody

Sign In for Pricing
View Details
SORL1 Antibody
MBS851715-03 0.1 mL (AF405S)

SORL1 Antibody

Sign In for Pricing
View Details