Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-13C-D-Phenylalanine
TRC-P319413-25MG 25 mg

1-13C-D-Phenylalanine

Sign In for Pricing
View Details
ICOS Blocking Peptide
MBS9626003-01 1 mg

ICOS Blocking Peptide

Sign In for Pricing
View Details
ICOS Blocking Peptide
MBS9626003-02 5x 1 mg

ICOS Blocking Peptide

Sign In for Pricing
View Details
RPL17P27 sgRNA CRISPR Lentivector (Human) (Target 3)
K1915004 1.0 µg DNA

RPL17P27 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
RALBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C6]
TA500897BM 100 µL

RALBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C6]

Sign In for Pricing
View Details
CCND1 (Cyclin D1, BCL1, D11S287E, PRAD1, U21B31)
244327 50 µg

CCND1 (Cyclin D1, BCL1, D11S287E, PRAD1, U21B31)

Sign In for Pricing
View Details