Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDY2A (NM_004825) Human Tagged ORF Clone Lentiviral Particle
RC220573L2V 200 µL

CDY2A (NM_004825) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Sphkap sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3440005 3x 1.0 µg

Sphkap sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal pan Cytokeratin Antibody (SPM583) [DyLight 488]
NBP2-34433G 0.1 mL

Mouse Monoclonal pan Cytokeratin Antibody (SPM583) [DyLight 488]

Sign In for Pricing
View Details
GENLISA™ Rat Thrombomodulin (TM) ELISA
KLR0681 1x 96 Well

GENLISA™ Rat Thrombomodulin (TM) ELISA

Sign In for Pricing
View Details
BLZF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV654273 1.0 µg DNA

BLZF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mmu-miR-3092-5p mimic
HY-R02974-01 5 nmol

Mmu-miR-3092-5p mimic

Sign In for Pricing
View Details