Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMPD1 AAV Vector (Human) (CMV)
44466101 1 µg

SMPD1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
ZNF704 ORF Vector (Human) (pORF)
ORF036348 1.0 µg DNA

ZNF704 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CCL28 Protein Vector (Rat) (pPB-C-His)
PV258218 500 ng

CCL28 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Mouse CD300a/LMIR1 Alexa Fluor 350 Antibody (Clone 172224)
FAB1186U-100UG 100 µg

Mouse CD300a/LMIR1 Alexa Fluor 350 Antibody (Clone 172224)

Sign In for Pricing
View Details
NCOR2 Rabbit pAb
E45R28176N-100 100 µL

NCOR2 Rabbit pAb

Sign In for Pricing
View Details
RAVER1 Protein Lysate (Rat) with C-HA Tag
38563036 100 µg

RAVER1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details