Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human STOML3, His-tagged
STOML3-3017H 25 µg

Recombinant Human STOML3, His-tagged

Sign In for Pricing
View Details
PAIP1 (NM_182789) Human Mass Spec Standard
PH302735 10 µg

PAIP1 (NM_182789) Human Mass Spec Standard

Sign In for Pricing
View Details
FOLR1 Polyclonal Antibody
E55A03079 100 µg

FOLR1 Polyclonal Antibody

Sign In for Pricing
View Details
Vitronectin (Vitronectin V10 Subunit, Vitronectin V65 Subunit, VN, VNT, VTN, Complement S Protein, Epibolin, S Protein, S-Protein, Serum Spreading Factor, Somatomedin B, Somatomedin-B, V75)
V2200-10G 1 mg

Vitronectin (Vitronectin V10 Subunit, Vitronectin V65 Subunit, VN, VNT, VTN, Complement S Protein, Epibolin, S Protein, S-Protein, Serum Spreading Factor, Somatomedin B, Somatomedin-B, V75)

Sign In for Pricing
View Details
Human CDC25C knockdown cell line
ABC-KD2764 1 Vial

Human CDC25C knockdown cell line

Sign In for Pricing
View Details
Anti-VAPA Antibody (7A704)
MF-0091774-01 25 µL

Anti-VAPA Antibody (7A704)

Sign In for Pricing
View Details