Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hmox1 3'UTR Luciferase Stable Cell Line
TU109628 1.0 mL

Hmox1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lambda 5 Rabbit Polyclonal Antibody
E28PT5641 100 µL

Lambda 5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Oosp1 (NM_133353) Mouse Tagged ORF Clone Lentiviral Particle
MR220736L4V 200 µL

Oosp1 (NM_133353) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SEPT4 ORF Vector (Human) (pORF)
ORF032156 1.0 µg DNA

SEPT4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-EGFR (Ab-1172)
Y021213 100 µg

Anti-EGFR (Ab-1172)

Sign In for Pricing
View Details
Glucocorticoid Receptor (NR3C1) (NM_001018077) Human Tagged Lenti ORF Clone
RC222342L3 10 µg

Glucocorticoid Receptor (NR3C1) (NM_001018077) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details