Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin vinyl sulfone, (HA-tag)
BML-UW0155-0025 25 µg

Ubiquitin vinyl sulfone, (HA-tag)

Sign In for Pricing
View Details
BC028528 (NM_153513) Mouse Tagged Lenti ORF Clone
MR201004L3 10 µg

BC028528 (NM_153513) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LAMA3 Antibody, FITC conjugated
A55816-50UG 50 µg

LAMA3 Antibody, FITC conjugated

Sign In for Pricing
View Details
RET ligand-1
MF-0113318-01 10 mg

RET ligand-1

Sign In for Pricing
View Details
RET ligand-1
MF-0113318-02 50 mg

RET ligand-1

Sign In for Pricing
View Details
Rat RIO Kinase 1 ELISA Kit
MBS057764-01 48 Well

Rat RIO Kinase 1 ELISA Kit

Sign In for Pricing
View Details