Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Apolipoprotein L4 Antibody
NBP2-56108-25ul 25 µL

Rabbit Polyclonal Apolipoprotein L4 Antibody

Sign In for Pricing
View Details
SNRPGP13 Adenovirus (Human)
44998051 1.0 mL

SNRPGP13 Adenovirus (Human)

Sign In for Pricing
View Details
Pigs sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4765303 1.0 µg DNA

Pigs sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
mLxip (NM_177582) Mouse Tagged Lenti ORF Clone
MR225720L3 10 µg

mLxip (NM_177582) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Pig Mannosyl-oligosaccharide 1, 2-alpha-mannosidase IA, MAN1A1 ELISA Kit
MBS9339723-01 48 Well

Pig Mannosyl-oligosaccharide 1, 2-alpha-mannosidase IA, MAN1A1 ELISA Kit

Sign In for Pricing
View Details
Pig Mannosyl-oligosaccharide 1, 2-alpha-mannosidase IA, MAN1A1 ELISA Kit
MBS9339723-02 96 Well

Pig Mannosyl-oligosaccharide 1, 2-alpha-mannosidase IA, MAN1A1 ELISA Kit

Sign In for Pricing
View Details