Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal OPA1 Antibody (1E8-1D9) [HRP]
NBP1-71656H 0.1 mL

Mouse Monoclonal OPA1 Antibody (1E8-1D9) [HRP]

Sign In for Pricing
View Details
SYT12 Protein Lysate (Rat) with C-HA Tag
45996036 100 µg

SYT12 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
MHC Class 2 discontinued
M3887-11 2 mL

MHC Class 2 discontinued

Sign In for Pricing
View Details
HPLC Column, C8-Universal,5μm,120Å,7.8x250mm
13011372 1 PC

HPLC Column, C8-Universal,5μm,120Å,7.8x250mm

Sign In for Pricing
View Details
14,15-Epoxy-moxidectin (>85%)
TRC-E589243-100MG 100 mg

14,15-Epoxy-moxidectin (>85%)

Sign In for Pricing
View Details
Human MFAP5 HEK293 Overexpression Lysate
MBS8114981-01 0.3 mg

Human MFAP5 HEK293 Overexpression Lysate

Sign In for Pricing
View Details