Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdcd4 (NM_022265) Rat Tagged Lenti ORF Clone
RR208806L4 10 µg

Pdcd4 (NM_022265) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NKp46 (NCR1, LY94, CD335, NK-p46, Natural Cytotoxicity Receptor)
219102 100 µL

NKp46 (NCR1, LY94, CD335, NK-p46, Natural Cytotoxicity Receptor)

Sign In for Pricing
View Details
Olfr916 sgRNA CRISPR Lentivector set (Mouse)
K4285301 3x 1.0 µg

Olfr916 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse CTSK shRNA Plasmid
abx969883-01 150 µg

Mouse CTSK shRNA Plasmid

Sign In for Pricing
View Details
Mouse CTSK shRNA Plasmid
abx969883-02 300 µg

Mouse CTSK shRNA Plasmid

Sign In for Pricing
View Details
3-Hydroxy-2-nitrobenzoic Acid
TRC-H950898-500MG 500 mg

3-Hydroxy-2-nitrobenzoic Acid

Sign In for Pricing
View Details