Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat XAB2 siRNA
abx939953-01 15 nmol

Rat XAB2 siRNA

Sign In for Pricing
View Details
Rat XAB2 siRNA
abx939953-02 30 nmol

Rat XAB2 siRNA

Sign In for Pricing
View Details
Human Kit ligand ELISA Kit
MBS9425179-01 96 Tests

Human Kit ligand ELISA Kit

Sign In for Pricing
View Details
Human Kit ligand ELISA Kit
MBS9425179-02 5x 96 Tests

Human Kit ligand ELISA Kit

Sign In for Pricing
View Details
Protective protein/Cathepsin A Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6040R-BF750-01 20 µL

Protective protein/Cathepsin A Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Protective protein/Cathepsin A Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6040R-BF750-02 100 µL

Protective protein/Cathepsin A Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details