Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDONR223-GPNMB
PPL00922 1 Each

PDONR223-GPNMB

Sign In for Pricing
View Details
CD93 (NM_012072) Human Tagged Lenti ORF Clone
RC206980L3 10 µg

CD93 (NM_012072) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
AQP4 Polyclonal Antibody
UB-GEN-15798 100 µL

AQP4 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Shigella Sonnei iscA Protein (aa 1-107)
VAng-Lsx09797-50gEcoli 50 µg (E. coli)

Recombinant Shigella Sonnei iscA Protein (aa 1-107)

Sign In for Pricing
View Details
TLR9 (Toll-Like Receptor 9) Porcine ELISA Kit
H6427 96 Tests

TLR9 (Toll-Like Receptor 9) Porcine ELISA Kit

Sign In for Pricing
View Details
TUBB2A (Tubulin, beta 2A, TUBB, TUBB2, dJ40E16.7) (APC)
MBS6169562-01 0.1 mL

TUBB2A (Tubulin, beta 2A, TUBB, TUBB2, dJ40E16.7) (APC)

Sign In for Pricing
View Details