Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Mouse (HEK293, Fc)

CD79B protein, together with CD79A, initiates the B-cell antigen receptor complex (BCR) signaling cascade, which is critical for complex internalization and transport to late endosomes, promoting antigen presentation. CD79B enhances CD79A phosphorylation, possibly recruiting kinases or protective proteins. CD79B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD

Molecular Formula

15985 (Gene_ID) P15530 (V26-D158) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5V1 (Olfactory Receptor 5V1)
487755 100 µL

OR5V1 (Olfactory Receptor 5V1)

Sign In for Pricing
View Details
XXprep Kit for Total RNA (from Tissue, Cells, Bacteria)
6780RC050 50 Rkt

XXprep Kit for Total RNA (from Tissue, Cells, Bacteria)

Sign In for Pricing
View Details
Bovine High density lipoprotein, HDL ELISA Kit
YLA0340BO-01 48 Tests

Bovine High density lipoprotein, HDL ELISA Kit

Sign In for Pricing
View Details
Bovine High density lipoprotein, HDL ELISA Kit
YLA0340BO-02 96 Tests

Bovine High density lipoprotein, HDL ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (rBRD.3) [DyLight 550]
NBP3-08847R 100 µL

Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (rBRD.3) [DyLight 550]

Sign In for Pricing
View Details
Cmtm4 (NM_153582) Mouse Tagged ORF Clone Lentiviral Particle
MR202216L4V 200 µL

Cmtm4 (NM_153582) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details