Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM, Human (HEK293, His)

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (HEK293, His) is the recombinant human-derived OSM protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OSM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osm-protein-human-hek293-his.html

Purity

95.00

Smiles

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Molecular Formula

5008 (Gene_ID) P13725 (A26-R221) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) NPL4 Polyclonal Antibody
MBS7157132 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) NPL4 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human KLK5 Protein
ARP2742-01 10 µg

Recombinant Human KLK5 Protein

Sign In for Pricing
View Details
Recombinant Human KLK5 Protein
ARP2742-02 50 µg

Recombinant Human KLK5 Protein

Sign In for Pricing
View Details
Recombinant Human KLK5 Protein
ARP2742-03 100 µg

Recombinant Human KLK5 Protein

Sign In for Pricing
View Details
Recombinant Human KLK5 Protein
ARP2742-04 1 mg

Recombinant Human KLK5 Protein

Sign In for Pricing
View Details
Recombinant Human CD350/FZD10 Protein, C-His
HV512011-01 50 µg

Recombinant Human CD350/FZD10 Protein, C-His

Sign In for Pricing
View Details