Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-36 gamma protein (IL36G) (Active)

Product Specifications

Product Name Alternative

IL-1-related protein 2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 family member 9, IL-1F9

Abbreviation

Recombinant Human IL36G protein (Active)

Gene Name

IL36G

UniProt

Q9NZH8

Expression Region

18-169aa

Organism

Homo sapiens (Human)

Target Sequence

SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation: activates mitogen-activated protein kinases and NF-kappa B in primary lung fibroblasts, and stimulates the expression of IL-8 and CXCL3 and Th17 chemokine CCL20 in lung fibroblasts. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. {ECO:0000269|PubMed:11466363, ECO:0000269|PubMed:20870894, ECO:0000269|PubMed:21965679, ECO:0000269|PubMed:23095752, ECO:0000269|PubMed:23147407, ECO:0000269|PubMed:24829417}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to induce IL-8 secretion by human preadipocytes is less than 10 ng/ml, corresponding to a specific activity of > 1 x 105 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/11098345/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PRUNE, CT (PRUNE, Protein prune homolog, Drosophila-related expressed sequence 17, HTcD37) (PE)
MBS6338028-01 0.2 mL

PRUNE, CT (PRUNE, Protein prune homolog, Drosophila-related expressed sequence 17, HTcD37) (PE)

Ask
View Details
PRUNE, CT (PRUNE, Protein prune homolog, Drosophila-related expressed sequence 17, HTcD37) (PE)
MBS6338028-02 5x 0.2 mL

PRUNE, CT (PRUNE, Protein prune homolog, Drosophila-related expressed sequence 17, HTcD37) (PE)

Ask
View Details
PE Linked Monoclonal Antibody to Interleukin 2 Receptor Beta (IL2Rb)
MBS2128962-01 0.1 mL

PE Linked Monoclonal Antibody to Interleukin 2 Receptor Beta (IL2Rb)

Ask
View Details
PE Linked Monoclonal Antibody to Interleukin 2 Receptor Beta (IL2Rb)
MBS2128962-02 0.2 mL

PE Linked Monoclonal Antibody to Interleukin 2 Receptor Beta (IL2Rb)

Ask
View Details
PE Linked Monoclonal Antibody to Interleukin 2 Receptor Beta (IL2Rb)
MBS2128962-03 0.5 mL

PE Linked Monoclonal Antibody to Interleukin 2 Receptor Beta (IL2Rb)

Ask
View Details
PE Linked Monoclonal Antibody to Interleukin 2 Receptor Beta (IL2Rb)
MBS2128962-04 1 mL

PE Linked Monoclonal Antibody to Interleukin 2 Receptor Beta (IL2Rb)

Ask
View Details