Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mucin-2/MUC2, Human (P.pastoris, His)

Mucin-2/MUC2 Protein, Human (P.pastoris, His) is the recombinant human-derived Mucin-2/MUC2, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Mucin-2/MUC2 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mucin-2-muc2-protein-human-p-pastoris-his.html

Purity

98.00

Smiles

VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL

Molecular Formula

4583 (Gene_ID) Q02817 (V36-L240) (Accession)

Molecular Weight

Approximately 32 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Aoc-OH·HCl
5-04556 25 g

8-Aoc-OH·HCl

Sign In for Pricing
View Details
TIMP3 Antibody, HRP conjugated
A36621-50UG 50 µg

TIMP3 Antibody, HRP conjugated

Sign In for Pricing
View Details
Bovine Nuclear apoptosis-inducing factor 1, NAIF1 ELISA KIT
ELI-03541b 96 Tests

Bovine Nuclear apoptosis-inducing factor 1, NAIF1 ELISA KIT

Sign In for Pricing
View Details
X-ray repair cross-complementing protein 6 Polyclonal Antibody
MBS9415943-01 0.1 mg

X-ray repair cross-complementing protein 6 Polyclonal Antibody

Sign In for Pricing
View Details
X-ray repair cross-complementing protein 6 Polyclonal Antibody
MBS9415943-02 5x 0.1 mg

X-ray repair cross-complementing protein 6 Polyclonal Antibody

Sign In for Pricing
View Details
PICALM siRNA (Human)
CRH5431-01 15 nmol

PICALM siRNA (Human)

Sign In for Pricing
View Details