Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mucin-2/MUC2, Human (P.pastoris, His)

Mucin-2/MUC2 Protein, Human (P.pastoris, His) is the recombinant human-derived Mucin-2/MUC2, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Mucin-2/MUC2 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/mucin-2-muc2-protein-human-p-pastoris-his.html

Purity

98.00

Smiles

VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL

Molecular Formula

4583 (Gene_ID) Q02817 (V36-L240) (Accession)

Molecular Weight

Approximately 32 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Midkine ELISA Kit
MBS9425903-01 96 Tests

Human Midkine ELISA Kit

Sign In for Pricing
View Details
Human Midkine ELISA Kit
MBS9425903-02 5x 96 Tests

Human Midkine ELISA Kit

Sign In for Pricing
View Details
Mouse Srr (NM_013761) AAV Particle
MR205071A1V 250 µL

Mouse Srr (NM_013761) AAV Particle

Sign In for Pricing
View Details
HSV I/II Glycoprotein D Matched Antibody Pair Set [ABP-S-07168]
ABP-S-07168 5 Plates

HSV I/II Glycoprotein D Matched Antibody Pair Set [ABP-S-07168]

Sign In for Pricing
View Details
HMGN2/HMG17 Recombinant Antibody, APC-Cy7 Conjugated
bsm-62335R-APC-Cy7 100 µL

HMGN2/HMG17 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Rad17 Antibody
TA336266 100 µg

Rabbit Polyclonal Rad17 Antibody

Sign In for Pricing
View Details