Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus Placenta-expressed transcript 1 protein (PLET1)

Product Specifications

Product Name Alternative

Antigen AgK114

Abbreviation

Recombinant Mesocricetus auratus PLET1 protein

Gene Name

PLET1

UniProt

Q5W9T8

Expression Region

27-223aa

Organism

Mesocricetus auratus (Golden hamster)

Target Sequence

ASYNDPCTVFDTISTTNLRVNITAEGSGENITYTVWVHVNSSVSVVILKAVNQDNKPVGTWVGATQECNDSSVLYRVTPSDNSDFQATWIVPNSEDITKVNLHVLMAIGNGTAAVTSVNLGEPQTSTPLRPTPEISETNQTTTMTTDKTPAMTTAKTPAMTTAKTTAKTTAKTTVKTTAMTTAKTTAKSLAVNALGS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cell Biology

Relevance

Modulates leading keratinocyte migration and cellular adhesion to matrix proteins during a wound-healing response and promotes wound repair. May play a role during trichilemmal differentiation of the hair follicle (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.8 kDa

References & Citations

"Identification of the novel membrane-associated protein AgK114 on hamster keratinocytes recognized by a monoclonal antibody K114." Tatefuji T., Arai C., Okura T., Kayano T., Mori T., Takakura-Yamamoto R., Takeuchi M., Ohta T., Kurimoto M. Biol. Pharm. Bull. 27:1742-1749 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody [Clone ID: OTI1G8]
TA801596S 30 µL

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody [Clone ID: OTI1G8]

Ask
View Details
Chicken Myosin light chain kinase, smooth muscle (MYLK) ELISA Kit
MBS7248341-01 48 Well

Chicken Myosin light chain kinase, smooth muscle (MYLK) ELISA Kit

Ask
View Details
Chicken Myosin light chain kinase, smooth muscle (MYLK) ELISA Kit
MBS7248341-02 96 Well

Chicken Myosin light chain kinase, smooth muscle (MYLK) ELISA Kit

Ask
View Details
Chicken Myosin light chain kinase, smooth muscle (MYLK) ELISA Kit
MBS7248341-03 5x 96 Well

Chicken Myosin light chain kinase, smooth muscle (MYLK) ELISA Kit

Ask
View Details
Chicken Myosin light chain kinase, smooth muscle (MYLK) ELISA Kit
MBS7248341-04 10x 96 Well

Chicken Myosin light chain kinase, smooth muscle (MYLK) ELISA Kit

Ask
View Details
Ldah (NM_001167767) Mouse Tagged ORF Clone Lentiviral Particle
MR214865L4V 200 µL

Ldah (NM_001167767) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details