Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSTL1, Human (HEK293, Fc)

Cystatin-like protein 1 (CSTL1) is a member of the cystatin family. CSTL1 Protein, Human (HEK293, Fc) is the recombinant human-derived CSTL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CSTL1 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cstl1-protein-human-hek293-fc.html

Purity

95.00

Smiles

AKLGHFQRWEGFQQKLMSKKNMNSTLNFFIQSYNNASNDTYLYRVQRLIRSQMQLTTGVEYIVTVKIGWTKCKRNDTSNSSCPLQSKKLRKSLICESLIYTMPWINYFQLWNNSCLEAEHVGRNLR

Molecular Formula

128817 (Gene_ID) Q9H114 (A20-R145) (Accession)

Molecular Weight

Approximately 45-80 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHBDL1 (NM_003961) Human Tagged Lenti ORF Clone
RC221768L4 10 µg

RHBDL1 (NM_003961) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
mLX (NM_198204) Human Tagged ORF Clone Lentiviral Particle
RC201911L4V 200 µL

mLX (NM_198204) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SORD Protein Lysate (Rat) with C-HA Tag
45120036 100 µg

SORD Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
HMG4/HMGB3 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-8809R-BF555 100 µL

HMG4/HMGB3 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Cy5.5 HA (MW 500000)
HY-D2663 1 Each

Cy5.5 HA (MW 500000)

Sign In for Pricing
View Details
PENK 3'UTR Lenti-reporter-Luc Vector
36385081 1.0 µg

PENK 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details