Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLO1/Glyoxalase I, Mouse (His)

GLO1 is an important enzyme responsible for catalyzing the conversion of hemithiol (the product of methylglyoxal and glutathione) to S-lactoylglutathione. This enzyme activity plays a crucial role in cellular detoxification by mitigating the effects of methylglyoxal, a reactive carbonyl species. GLO1/Glyoxalase I Protein, Mouse (His) is the recombinant mouse-derived GLO1/Glyoxalase I protein, expressed by E. coli , with N-His, N-6*His labeled tag.

Product Specifications

Product Name Alternative

GLO1/Glyoxalase I Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/glo1-glyoxalase-i-protein-mouse-his.html

Purity

95.0

Smiles

AEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKIATII

Molecular Formula

109801 (Gene_ID) Q9CPU0/NP_079650.3 (A2-I184) (Accession)

Molecular Weight

Approximately 25&48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human phosphoglycerate mutase 2, PGAM2 ELISA Kit
YLA2390HU-01 48 Tests

Human phosphoglycerate mutase 2, PGAM2 ELISA Kit

Sign In for Pricing
View Details
Human phosphoglycerate mutase 2, PGAM2 ELISA Kit
YLA2390HU-02 96 Tests

Human phosphoglycerate mutase 2, PGAM2 ELISA Kit

Sign In for Pricing
View Details
UBC9 Recombinant Rabbit Monoclonal Antibody [SC0534]
ET1610-21 100 µL

UBC9 Recombinant Rabbit Monoclonal Antibody [SC0534]

Sign In for Pricing
View Details
MEK6 (MAP2K6) (NM_002758) Human Recombinant Protein
TP304481 20 µg

MEK6 (MAP2K6) (NM_002758) Human Recombinant Protein

Sign In for Pricing
View Details
Rno-miR-429 miRNA Antagomir
CIS0173-01 10 nmol

Rno-miR-429 miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-429 miRNA Antagomir
CIS0173-02 20 nmol

Rno-miR-429 miRNA Antagomir

Sign In for Pricing
View Details