Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adipocyte plasma membrane-associated protein (APMAP), partial

Product Specifications

Product Name Alternative

Protein BSCv

Abbreviation

Recombinant Human APMAP protein, partial

Gene Name

APMAP

UniProt

Q9HDC9

Expression Region

62-416aa

Organism

Homo sapiens (Human)

Target Sequence

ESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Exhibits strong arylesterase activity with beta-naphthyl acetate and phenyl acetate. May play a role in adipocyte differentiation.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS802839 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
USP15 Recombinant Rabbit monoclonal Antibody
HA723799 100 µL

USP15 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560205 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Monohexyl Phthalate
TRC-M546480-1G 1 g

Monohexyl Phthalate

Sign In for Pricing
View Details
3-(Benzophenone-4-carboxamido)-2-hemimaleaimidopropanoic Acid
TRC-B205550-10MG 10 mg

3-(Benzophenone-4-carboxamido)-2-hemimaleaimidopropanoic Acid

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), 1mg/mL
BNUM1784-50 1x 50 µL

Histone H1 (Nuclear Marker) (HH1/1784R), 1mg/mL

Sign In for Pricing
View Details