Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Betacellulin/BTC, Mouse (HEK293)

Probetacellulin Protein, Mouse (HEK293), a member of the epidermal growth factor (EGF) family, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes.

Product Specifications

Product Name Alternative

Betacellulin/BTC Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/probetacellulin-protein-mouse-hek293.html

Purity

95.0

Smiles

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY

Molecular Formula

12223 (Gene_ID) Q05928 (D32-Y111) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]Li L, et al. Betacellulin improves glucose metabolism by promoting conversion of intraislet precursor cells to beta-cells in streptozotocin-treated mice. Am J Physiol Endocrinol Metab. 2003 Sep;285 (3) :E577-83.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 Antibody
orb749317 100 Tests

CD20 Antibody

Sign In for Pricing
View Details
3- (2-Methoxyphenyl) -2-methyl-8-nitro-2,3,5,6-tetrahydro-4H-2,6-methano-1,3,5-benzoxadiazocine-4-thione
sc-492236 5 mg

3- (2-Methoxyphenyl) -2-methyl-8-nitro-2,3,5,6-tetrahydro-4H-2,6-methano-1,3,5-benzoxadiazocine-4-thione

Sign In for Pricing
View Details
GDPD2 Antibody (Center)
orb1933183-01 50 µL

GDPD2 Antibody (Center)

Sign In for Pricing
View Details
GDPD2 Antibody (Center)
orb1933183-02 100 µL

GDPD2 Antibody (Center)

Sign In for Pricing
View Details
AKT1 Rabbit pAb
MBS8546692-01 0.1 mL

AKT1 Rabbit pAb

Sign In for Pricing
View Details
AKT1 Rabbit pAb
MBS8546692-02 0.1 mL (AF405L)

AKT1 Rabbit pAb

Sign In for Pricing
View Details