Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chemerin/RARRES2, Mouse (HEK293, Fc)

Chemerin/RARRES2 proteins bind to signaling receptors and are involved in various processes, including promotion of adipocyte differentiation, protein phosphorylation, and insulin receptor signaling. It plays a role in brown adipocyte differentiation and is located in the extracellular region. Chemerin/RARRES2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Chemerin/RARRES2 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/chemerin-rarres2-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

TRGTEPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS

Molecular Formula

71660 (Gene_ID) Q9DD06/NP_082128.1 (T17-S156) (Accession)

Molecular Weight

Approximately 41.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-500 1x 500 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mesothelin (Mesothelial Marker) (MSLN/2131), CF405S conjugate, 0.1mg/mL
BNC042131-500 1x 500 µL

Mesothelin (Mesothelial Marker) (MSLN/2131), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-500 1x 500 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF647 conjugate, 0.1mg/mL
BNC471422-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF568 conjugate, 0.1mg/mL
BNC680859-500 1x 500 µL

Human Kappa Light Chain (Kap-56), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF640R conjugate, 0.1mg/mL
BNC400252-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details