Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GZMA/Granzyme A, Mouse (His-B2M)

GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Mouse (His-B2M) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli , with N-6*His, N-B2M labeled tag.

Product Specifications

Product Name Alternative

GZMA/Granzyme A Protein, Mouse (His-B2M), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gzma-protein-mouse-his-b2m.html

Purity

90.00

Smiles

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Molecular Formula

14938 (Gene_ID) P11032 (I29-V260) (Accession)

Molecular Weight

Approximately 39.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1040 CRISPR Activation Plasmid (m2)
sc-436541-ACT-2 20 µg

Olfr1040 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal NOL8 Antibody
NBP1-46849 100 µL

Rabbit Polyclonal NOL8 Antibody

Sign In for Pricing
View Details
SNORA36B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2216107 1.0 µg DNA

SNORA36B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
P2Y9 Antibody HRP Conjugated
MBS9460477-01 0.1 mL

P2Y9 Antibody HRP Conjugated

Sign In for Pricing
View Details
P2Y9 Antibody HRP Conjugated
MBS9460477-02 5x 0.1 mL

P2Y9 Antibody HRP Conjugated

Sign In for Pricing
View Details
IL12A (NM_000882) Human Tagged ORF Clone Lentiviral Particle
RC211224L2V 200 µL

IL12A (NM_000882) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details