Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3M, Human (His-SUMO)

The EIF3M protein is a component of the eIF-3 complex and promotes protein synthesis initiation (eg, mRNA recruitment, scanning, and ribosomal subunit attachment) (PubMed:17403899, PubMed:25849773) . EIF3M Protein, Human (His-SUMO) is the recombinant human-derived EIF3M protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

EIF3M Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif3m-protein-human-his-sumo.html

Smiles

SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

Molecular Formula

10480 (Gene_ID) Q7L2H7-1 (S2-T374) (Accession)

Molecular Weight

Approximately 58.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rimiducid (AP1903)
C14444-10mM/1mL 10 mM/1mL

Rimiducid (AP1903)

Sign In for Pricing
View Details
PKIG Protein Vector (Human) (pPB-C-His)
PV056325 500 ng

PKIG Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Lysmd3 shRNA (UAS) - Lentiviral mouse Lysmd3 shRNA (UAS, GFP) plasmid
GTR15203746 1 Vial

Lentiviral mouse Lysmd3 shRNA (UAS) - Lentiviral mouse Lysmd3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
NGF Polyclonal Antibody
E-AB-32239-01 20 µL

NGF Polyclonal Antibody

Sign In for Pricing
View Details
NGF Polyclonal Antibody
E-AB-32239-02 60 µL

NGF Polyclonal Antibody

Sign In for Pricing
View Details
NGF Polyclonal Antibody
E-AB-32239-03 120 µL

NGF Polyclonal Antibody

Sign In for Pricing
View Details