Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3M, Human (His-SUMO)

The EIF3M protein is a component of the eIF-3 complex and promotes protein synthesis initiation (eg, mRNA recruitment, scanning, and ribosomal subunit attachment) (PubMed:17403899, PubMed:25849773) . EIF3M Protein, Human (His-SUMO) is the recombinant human-derived EIF3M protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

EIF3M Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif3m-protein-human-his-sumo.html

Smiles

SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

Molecular Formula

10480 (Gene_ID) Q7L2H7-1 (S2-T374) (Accession)

Molecular Weight

Approximately 58.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Glu (t-Bu) Wang Resin
H0751501312.25G 25 g

Fmoc-Glu (t-Bu) Wang Resin

Sign In for Pricing
View Details
Glypican-3 (GPC3/863 + 1G12), CF555 conjugate, 0.1mg/mL
BNC550864-100 1x 100 µL

Glypican-3 (GPC3/863 + 1G12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTF1 (MTF1/2649), CF568 conjugate, 0.1mg/mL
BNC682649-500 1x 500 µL

MTF1 (MTF1/2649), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CERKL Antibody
8C11160-AAT 50 µg

CERKL Antibody

Sign In for Pricing
View Details
ARHGEF2 Antibody
8C18399-AAT 50 µg

ARHGEF2 Antibody

Sign In for Pricing
View Details
Neurofilament (H+L) (RT-97 + NR-4), CF647 conjugate, 0.1mg/mL
BNC471201-500 1x 500 µL

Neurofilament (H+L) (RT-97 + NR-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details