Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Artemin, Human

Artemin Protein, Human, a member of the glial cell line-derived neurotrophic factor (GDNF) family, is the ligand for the former orphan receptor GFRalpha3-RET. Artemin is a survival factor for sensory and sympathetic neurons in culture, and also influences these neurons in vivo[1].

Product Specifications

Product Name Alternative

Artemin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/artemin-protein-human.html

Purity

98.0

Smiles

AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG

Molecular Formula

9048 (Gene_ID) Q5T4W7 (A108-G220) (Accession)

Molecular Weight

Approximately 14.0 kDa

References & Citations

[1]R H Baloh, et al. Artemin, a novel member of the GDNF ligand family, supports peripheral and central neurons and signals through the GFRalpha3-RET receptor complex. Neuron. 1998 Dec;21 (6) :1291-302.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ERAS activation kit by CRISPRa
GA102232 1 Kit

Human ERAS activation kit by CRISPRa

Sign In for Pricing
View Details
NR5A2 (NM_003822) Human Over-expression Lysate
LY401255 100 µg

NR5A2 (NM_003822) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CCDC138 activation kit by CRISPRa
GA116120 1 Kit

Human CCDC138 activation kit by CRISPRa

Sign In for Pricing
View Details
Propargyl Chloride
TRC-P763000-5G 5 g

Propargyl Chloride

Sign In for Pricing
View Details
2-Benzoyl-5-ethylthiophene
TRC-B441910-1G 1 g

2-Benzoyl-5-ethylthiophene

Sign In for Pricing
View Details
SKF-525A Hydrochloride
TRC-S550000-250MG 250 mg

SKF-525A Hydrochloride

Sign In for Pricing
View Details