Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Artemin, Human

Artemin Protein, Human, a member of the glial cell line-derived neurotrophic factor (GDNF) family, is the ligand for the former orphan receptor GFRalpha3-RET. Artemin is a survival factor for sensory and sympathetic neurons in culture, and also influences these neurons in vivo[1].

Product Specifications

Product Name Alternative

Artemin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/artemin-protein-human.html

Purity

98.0

Smiles

AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG

Molecular Formula

9048 (Gene_ID) Q5T4W7 (A108-G220) (Accession)

Molecular Weight

Approximately 14.0 kDa

References & Citations

[1]R H Baloh, et al. Artemin, a novel member of the GDNF ligand family, supports peripheral and central neurons and signals through the GFRalpha3-RET receptor complex. Neuron. 1998 Dec;21 (6) :1291-302.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smim23 Rat siRNA Oligo Duplex (Locus ID 360508)
SR514269 1 Kit

Smim23 Rat siRNA Oligo Duplex (Locus ID 360508)

Sign In for Pricing
View Details
MYSM1 Lentiviral Activation Particles (h2)
sc-405349-LAC-2 200 µL

MYSM1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Dimeric Lewis X hexasaccharide-APE-HSA
OD03881 1 g

Dimeric Lewis X hexasaccharide-APE-HSA

Sign In for Pricing
View Details
MAPK7 Rabbit Polyclonal Antibody
E10G07278 100 µL

MAPK7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KIR3DX1 Adenovirus (Human)
25720051 1.0 mL

KIR3DX1 Adenovirus (Human)

Sign In for Pricing
View Details
RPL13 Recombinant Antibody
bsm-62547R-01 20 µL

RPL13 Recombinant Antibody

Sign In for Pricing
View Details