Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 60S acidic ribosomal protein P2 (RPLP2), partial

Product Specifications

Product Name Alternative

Renal carcinoma antigen NY-REN-44

Abbreviation

Recombinant Human RPLP2 protein, partial

Gene Name

RPLP2

UniProt

P05387

Expression Region

1-113aa

Organism

Homo sapiens (Human)

Target Sequence

MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGL

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Plays an important role in the elongation step of protein synthesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in the elongation step of protein synthesis.

Molecular Weight

38.4 kDa

References & Citations

Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CK1 alpha antibody
70R-51792 100 ul

CK1 alpha antibody

Ask
View Details
hCG beta (CGB5) (NM_033043) Human Tagged ORF Clone Lentiviral Particle
RC205928L2V 200 µL

hCG beta (CGB5) (NM_033043) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
CALU, CT (CALU, Calumenin, Crocalbin, IEF SSP 9302) (AP)
MBS6280573-01 0.2 mL

CALU, CT (CALU, Calumenin, Crocalbin, IEF SSP 9302) (AP)

Ask
View Details
CALU, CT (CALU, Calumenin, Crocalbin, IEF SSP 9302) (AP)
MBS6280573-02 5x 0.2 mL

CALU, CT (CALU, Calumenin, Crocalbin, IEF SSP 9302) (AP)

Ask
View Details
MRPL14 (39S Ribosomal Protein L14, Mitochondrial, L14mt, MRP-L14, 39S Ribosomal Protein L32, Mitochondrial, L32mt, MRP-L32, MRPL14, MRPL32, RPML32)
324380-01 50 µg

MRPL14 (39S Ribosomal Protein L14, Mitochondrial, L14mt, MRP-L14, 39S Ribosomal Protein L32, Mitochondrial, L32mt, MRP-L32, MRPL14, MRPL32, RPML32)

Ask
View Details
MRPL14 (39S Ribosomal Protein L14, Mitochondrial, L14mt, MRP-L14, 39S Ribosomal Protein L32, Mitochondrial, L32mt, MRP-L32, MRPL14, MRPL32, RPML32)
324380-02 100 µg

MRPL14 (39S Ribosomal Protein L14, Mitochondrial, L14mt, MRP-L14, 39S Ribosomal Protein L32, Mitochondrial, L32mt, MRP-L32, MRPL14, MRPL32, RPML32)

Ask
View Details