Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Human (HEK293, His)

Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human (HEK293, His) is the recombinant human-derived Prolactin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Prolactin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-protein-human-hek-293-his.html

Purity

98.0

Smiles

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Molecular Formula

5617 (Gene_ID) P01236 (L29-C227) (Accession)

Molecular Weight

Approximately 24-30 kDa due to the glycosylation.

References & Citations

[1]Sun R, et al., Recombinant human prolactin improves antitumor effects of murine natural killer cells in vitro and in vivo. Neuroimmunomodulation. 2002-2003;10 (3) :169-76.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC2 (F-4) Alexa Fluor® 647
sc-365854 AF647 200 µg/mL

XRCC2 (F-4) Alexa Fluor® 647

Sign In for Pricing
View Details
Snapc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3675508 1.0 µg DNA

Snapc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ERBB2 Protein (N-GST, Human)
P524387 100 µg

ERBB2 Protein (N-GST, Human)

Sign In for Pricing
View Details
Recombinant Human Resistin-like beta (RETNLB)
orb1649775-01 20 µg

Recombinant Human Resistin-like beta (RETNLB)

Sign In for Pricing
View Details
Recombinant Human Resistin-like beta (RETNLB)
orb1649775-02 100 µg

Recombinant Human Resistin-like beta (RETNLB)

Sign In for Pricing
View Details
Recombinant Human Resistin-like beta (RETNLB)
orb1649775-03 1 mg

Recombinant Human Resistin-like beta (RETNLB)

Sign In for Pricing
View Details