Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin, Mouse (CHO)

Noggin protein is an important BMP inhibitor that plays an indispensable role in the neural tube, somite growth, cartilage morphogenesis, and joint formation. Its homodimeric structure promotes significant interactions with GDF5 and possibly GDF6, inhibiting chondrocyte differentiation. Noggin Protein, Mouse (CHO) is the recombinant mouse-derived Noggin protein, expressed in CHO.

Product Specifications

Product Name Alternative

Noggin Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-mouse-cho.html

Purity

97.00

Smiles

LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

18121 (Gene_ID) P97466 (L20-C232) (Accession)

Molecular Weight

Approximately 28-31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Valenzuela DM, et al. Identification of mammalian noggin and its expression in the adult nervous system. J Neurosci. 1995 Sep;15 (9) :6077-84.|[2]Brunet LJ, et al. Noggin, cartilage morphogenesis, and joint formation in the mammalian skeleton. Science. 1998 May 29;280 (5368) :1455-7.|[3]Smith WC, et al. Secreted noggin protein mimics the Spemann organizer in dorsalizing Xenopus mesoderm. Nature. 1993 Feb 11;361 (6412) :547-9.|[4]Groppe J, et al. Structural basis of BMP signalling inhibition by the cystine knot protein Noggin. Nature. 2002 Dec 12;420 (6916) :636-42.|[5]Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100 (4) :824-34.|[6]Matsuura I, et al., BMP inhibition enhances axonal growth and functional recovery after spinal cord injury. J Neurochem. 2008 May;105 (4) :1471-9

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PE/Cyanine5.5 Anti-Mouse Ly6A/E (Sca-1) Antibody
MBS4514805-01 20 Tests

PE/Cyanine5.5 Anti-Mouse Ly6A/E (Sca-1) Antibody

Ask
View Details
PE/Cyanine5.5 Anti-Mouse Ly6A/E (Sca-1) Antibody
MBS4514805-02 50 Tests

PE/Cyanine5.5 Anti-Mouse Ly6A/E (Sca-1) Antibody

Ask
View Details
PE/Cyanine5.5 Anti-Mouse Ly6A/E (Sca-1) Antibody
MBS4514805-03 100 Tests

PE/Cyanine5.5 Anti-Mouse Ly6A/E (Sca-1) Antibody

Ask
View Details
PE/Cyanine5.5 Anti-Mouse Ly6A/E (Sca-1) Antibody
MBS4514805-04 500 Tests

PE/Cyanine5.5 Anti-Mouse Ly6A/E (Sca-1) Antibody

Ask
View Details
PE/Cyanine5.5 Anti-Mouse Ly6A/E (Sca-1) Antibody
MBS4514805-05 5x 500 Tests

PE/Cyanine5.5 Anti-Mouse Ly6A/E (Sca-1) Antibody

Ask
View Details
Human UDP Glycosyltransferase 8 (UGT8) ELISA Kit
MBS4503218-01 48 Tests

Human UDP Glycosyltransferase 8 (UGT8) ELISA Kit

Ask
View Details