IL-12R beta 1, Human (HEK293, His)
IL-12R beta 1 protein is an IL-12 cytokine surface receptor that activates the Jak-Stat signaling cascade pathway and is involved in IL-12-mediated immune regulation. IL-12R beta 1 Protein, Human (HEK293, His) is expressed by HEK293 cells with a C-terminal 6*His tag[1].
Product Specifications
Product Name Alternative
IL-12R beta 1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-12r-beta-1-protein-human-hek293-his.html
Purity
98.0
Smiles
CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE
Molecular Formula
3594 (Gene_ID) P42701-1 (C24-E540) (Accession)
Molecular Weight
80-110 kDa
References & Citations
[1]C E Verhagen, et al. Residual type 1 immunity in patients genetically deficient for interleukin 12 receptor beta1 (IL-12Rbeta1) : evidence for an IL-12Rbeta1-independent pathway of IL-12 responsiveness in human T cells. J Exp Med. 2000 Aug 21;192 (4) :517-28.|[2]Esther van de Vosse, et al. IL-12Rβ1 deficiency: mutation update and description of the IL12RB1 variation database. Hum Mutat. 2013 Oct;34 (10) :1329-39.|[3]H Nagayama, et al. IL-12 responsiveness and expression of IL-12 receptor in human peripheral blood monocyte-derived dendritic cells. J Immunol. 2000 Jul 1;165 (1) :59-66.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472848-100 1x 100 µL
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400204-100 1x 100 µL
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941081-500 1x 500 µL
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041556-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details