Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plexin B1, Human (HEK293, mFc)

Plexin B1 protein is a receptor for SEMA4D and has a critical influence on GABAergic and inhibitory synapse development. It activates RHOA, leading to changes in the actin cytoskeleton, affecting axonal guidance, invasive growth and cell migration. Plexin B1 Protein, Human (HEK293, mFc) is the recombinant human-derived Plexin B1 protein, expressed by HEK293 , with N-mFc labeled tag.

Product Specifications

Product Name Alternative

Plexin B1 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plexin-b1-protein-human-hek293-mfc.html

Purity

98.0

Smiles

LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ

Molecular Formula

5364 (Gene_ID) O43157 (L20-Q535) (Accession)

Molecular Weight

Approximately 85 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOC3L Protein Vector (Rat) (pPB-C-His)
PV285566 500 ng

NOC3L Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Pik3r2 (NM_022185) Rat Tagged Lenti ORF Clone
RR213609L4 10 µg

Pik3r2 (NM_022185) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Rabbit anti-Bovine IgG Fc Secondary Antibody [PerCP]
NBP1-72769PCP 0.5 mL

Rabbit Polyclonal Rabbit anti-Bovine IgG Fc Secondary Antibody [PerCP]

Sign In for Pricing
View Details
Rat Monoclonal Integrin alpha V + beta 6 Antibody (Av beta 6 62ow.17) [Alexa Fluor 488]
NBP2-50450AF488 0.1 mL

Rat Monoclonal Integrin alpha V + beta 6 Antibody (Av beta 6 62ow.17) [Alexa Fluor 488]

Sign In for Pricing
View Details
INSRR antibody
70R-17986 50 ul

INSRR antibody

Sign In for Pricing
View Details
uPA (PLAU) Human qPCR Template Standard (NM_002658)
HK205660 1 Kit

uPA (PLAU) Human qPCR Template Standard (NM_002658)

Sign In for Pricing
View Details