Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Centrin-2, Human (His)

Centrin-2 protein plays a critical role in microtubule-organized centromere structure, directing centriole duplication, spindle formation, and regulation of cytokinesis. It ensures genome stability by interacting with CALM1 and CCP110. Centrin-2 Protein, Human (His) is the recombinant human-derived Centrin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Centrin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/centrin-2-protein-human-his.html

Purity

90.10

Smiles

ASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY

Molecular Formula

1069 (Gene_ID) P41208 (A2-Y172) (Accession)

Molecular Weight

Approximately 20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fkbp5 Pre-designed siRNA Set B
SI104962B 1 Each

Mouse Fkbp5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit monoclonal anti-HA tag Antibody, clone OTIR7C9
TA591011 100 µL

Rabbit monoclonal anti-HA tag Antibody, clone OTIR7C9

Sign In for Pricing
View Details
Human IFN-gammaR1-CDw119 ELISA Kit
MBS3800149-01 48 Well

Human IFN-gammaR1-CDw119 ELISA Kit

Sign In for Pricing
View Details
Human IFN-gammaR1-CDw119 ELISA Kit
MBS3800149-02 96 Well

Human IFN-gammaR1-CDw119 ELISA Kit

Sign In for Pricing
View Details
Human IFN-gammaR1-CDw119 ELISA Kit
MBS3800149-03 5x 96 Well

Human IFN-gammaR1-CDw119 ELISA Kit

Sign In for Pricing
View Details
Human IFN-gammaR1-CDw119 ELISA Kit
MBS3800149-04 10x 96 Well

Human IFN-gammaR1-CDw119 ELISA Kit

Sign In for Pricing
View Details