Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF164, Mouse (164a.a, P.pastoris)

VEGF-A Protein is a key member of the VEGF family of cytokines.VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability.VEGF-A stimulates endothelial cell mitogenesis and cell migration.VEGF164 Protein, Mouse (P.pastoris) is the recombinant mouse-derived VEGF164 protein, expressed by P.pastoris , with tag free.

Product Specifications

Product Name Alternative

VEGF164 Protein, Mouse (164a.a, P.pastoris), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf164-protein-mouse-1654a-a-p-pastoris.html

Purity

95.0

Smiles

APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

22339 (Gene_ID) Q00731-2 (A27-R190) (Accession)

Molecular Weight

Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z-Gly-OSu
C-1665.0100 100.0g

Z-Gly-OSu

Sign In for Pricing
View Details
SLC25A20 Rabbit Polyclonal Antibody
TA334169 100 µL

SLC25A20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mesothelin Rabbit Monoclonal Antibody
AMRe86368-01 1 Each

Mesothelin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mesothelin Rabbit Monoclonal Antibody
AMRe86368-02 50 µL

Mesothelin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mesothelin Rabbit Monoclonal Antibody
AMRe86368-03 100 µL

Mesothelin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SHC3 (SHC-transforming Protein 3, Src Homology 2 Domain-containing-transforming Protein C3, SH2 Domain Protein C3, SHC-transforming Protein C, Neuronal Shc, N-Shc, Protein Rai, SHCC, NSHC)
133317 50 µg

SHC3 (SHC-transforming Protein 3, Src Homology 2 Domain-containing-transforming Protein C3, SH2 Domain Protein C3, SHC-transforming Protein C, Neuronal Shc, N-Shc, Protein Rai, SHCC, NSHC)

Sign In for Pricing
View Details