Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSWIM4 Lentiviral Activation Particles (m2)

Product Specifications

No additional specifications available.

More Discoveries

Explore Other Products

Browse additional items from our catalog

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
MBS5818107 Inquire

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Sign In for Pricing
View Details
Rat Nitric Oxide Synthase 1, Neuronal (NOS1) Antibody Pair Kit (with Standard)
MBS2089985-01 5x 96 Tests

Rat Nitric Oxide Synthase 1, Neuronal (NOS1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Nitric Oxide Synthase 1, Neuronal (NOS1) Antibody Pair Kit (with Standard)
MBS2089985-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Nitric Oxide Synthase 1, Neuronal (NOS1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Nitric Oxide Synthase 1, Neuronal (NOS1) Antibody Pair Kit (with Standard)
MBS2089985-03 10x 96 Tests

Rat Nitric Oxide Synthase 1, Neuronal (NOS1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Nitric Oxide Synthase 1, Neuronal (NOS1) Antibody Pair Kit (with Standard)
MBS2089985-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Nitric Oxide Synthase 1, Neuronal (NOS1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF354C Antibody [Biotin]
NBP3-06035B 0.1 mL

Rabbit Polyclonal ZNF354C Antibody [Biotin]

Sign In for Pricing
View Details