Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Reticulon-3 (Rtn3), partial

Product Specifications

Abbreviation

Recombinant Mouse Rtn3 protein, partial

Gene Name

Rtn3

UniProt

Q9ES97

Expression Region

182-440aa

Organism

Mus musculus (Mouse)

Target Sequence

KDQEPKNPNKVPDGEDRSALDFGQSKAEHICTYSLSPSELPVASVEKDSPESPFEVIIDKATFDREFKDLYKENPNDLGGWAAHGDRESPADLLEMNDKLFPLRNKEAGRYPSSVLLGRQFSHTTAALEEVSRCVNDMHNFTNEILTWDLDPQAKQQANKTSCTTESTGLDRSELRSEIPVINLKTNPQQKMPVCSFNGSTPITKSTGDWTEAFTEGKPVRDYLSSTKEAGGNGVPGSSQLHSELPGSMPEKWVSGSGA

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress . Induces the formation of endoplasmic reticulum tubules. Acts also as an inflammation-resolving regulator by interacting with both TRIM25 and RIG-I/DDX58, subsequently impairing DDX58 'Lys-63'-linked polyubiquitination leading to IRF3 and NF-kappa-B inhibition .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.9 kDa

References & Citations

"Arl6IP1 has the ability to shape the mammalian ER membrane in a reticulon-like fashion." Yamamoto Y., Yoshida A., Miyazaki N., Iwasaki K., Sakisaka T. Biochem. J. 458:69-79 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Klebsiella Pneumoniae sulA Protein (aa 1-169) (strain ATCC 700721 / MGH 78578)
VAng-Cr5466-500gEcoli 500 µg (E. coli)

Recombinant Klebsiella Pneumoniae sulA Protein (aa 1-169) (strain ATCC 700721 / MGH 78578)

Sign In for Pricing
View Details
SETBP1 (NM_001130110) Human Tagged Lenti ORF Clone
RC225305L4 10 µg

SETBP1 (NM_001130110) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Exosc5 Pre-designed siRNA Set A
SI204666A 1 Each

Rat Exosc5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Angiopoietin 2 (ANGPT2) Antibody (Biotin)
abx105137-01 20 µg

Angiopoietin 2 (ANGPT2) Antibody (Biotin)

Sign In for Pricing
View Details
Angiopoietin 2 (ANGPT2) Antibody (Biotin)
abx105137-02 50 µg

Angiopoietin 2 (ANGPT2) Antibody (Biotin)

Sign In for Pricing
View Details
Angiopoietin 2 (ANGPT2) Antibody (Biotin)
abx105137-03 100 µg

Angiopoietin 2 (ANGPT2) Antibody (Biotin)

Sign In for Pricing
View Details