Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF6, Human

KLF6 Protein, a transcriptional activator, binds GC box motifs and may contribute to B-cell growth and development. It interacts with ZZEF1. KLF6 Protein, Human is the recombinant human-derived KLF6 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

KLF6 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klf6-protein-human.html

Purity

95.0

Smiles

MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVS

Molecular Formula

1316 (Gene_ID) Q99612-3 (M1-S109) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Mouse anti Human CD41 (gpIIb)
MBS550102-01 0.5 mg

Monoclonal Mouse anti Human CD41 (gpIIb)

Sign In for Pricing
View Details
Monoclonal Mouse anti Human CD41 (gpIIb)
MBS550102-02 1 mg

Monoclonal Mouse anti Human CD41 (gpIIb)

Sign In for Pricing
View Details
2- (2-Oxopiperidin-1-yl) propanoic acid
WQA12992-01 100 mg

2- (2-Oxopiperidin-1-yl) propanoic acid

Sign In for Pricing
View Details
2- (2-Oxopiperidin-1-yl) propanoic acid
WQA12992-02 1 g

2- (2-Oxopiperidin-1-yl) propanoic acid

Sign In for Pricing
View Details
Recombinant Human TNF-alpha Protein, Untagged, E.coli-10ug
QP10353-ec-10ug 10ug

Recombinant Human TNF-alpha Protein, Untagged, E.coli-10ug

Sign In for Pricing
View Details
TPRKB Polyclonal Antibody, FITC Conjugated
A68176-050 50 µL

TPRKB Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details