Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF6, Human

KLF6 Protein, a transcriptional activator, binds GC box motifs and may contribute to B-cell growth and development. It interacts with ZZEF1. KLF6 Protein, Human is the recombinant human-derived KLF6 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

KLF6 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klf6-protein-human.html

Purity

95.0

Smiles

MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVS

Molecular Formula

1316 (Gene_ID) Q99612-3 (M1-S109) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

trans-4-Butylcyclohexanecarboxylic Acid
TRC-T705168-100MG 100 mg

trans-4-Butylcyclohexanecarboxylic Acid

Sign In for Pricing
View Details
Mouse Monoclonal Nitrotyrosine Antibody (HM11)
NB600-1024 0.05 mg

Mouse Monoclonal Nitrotyrosine Antibody (HM11)

Sign In for Pricing
View Details
IgG2a, k Mouse Isotype Control (Biotin)
367176 100 µg

IgG2a, k Mouse Isotype Control (Biotin)

Sign In for Pricing
View Details
ITGA1 Antibody (Center)
orb1928268 400 µL

ITGA1 Antibody (Center)

Sign In for Pricing
View Details
BP Fluor 350 azide
HY-W800692 1 Each

BP Fluor 350 azide

Sign In for Pricing
View Details
SGT1/ECD Rabbit Polyclonal Antibody
orb763036 100 µg

SGT1/ECD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details