IL-33, Mouse
IL-33 Protein, Mouse is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation.
Product Specifications
Product Name Alternative
IL-33 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-33-protein-mouse.html
Purity
98.0
Smiles
SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Molecular Formula
77125 (Gene_ID) Q8BVZ5 (S109-I266) (Accession)
Molecular Weight
Approximately 17-22 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Liew FY, et al. Interleukin-33 in health and disease. Nat Rev Immunol. 2016 Nov;16 (11) :676-689.|[2]Cayrol C, et al. Interleukin-33 (IL-33) : A nuclear cytokine from the IL-1 family. Immunol Rev. 2018 Jan;281 (1) :154-168.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402168-100 1x 100 µL
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941097-500 1x 500 µL
CD44 Standard (HCAM/1097), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
