Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Mouse

IL-33 Protein, Mouse is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation.

Product Specifications

Product Name Alternative

IL-33 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-mouse.html

Purity

98.0

Smiles

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Molecular Formula

77125 (Gene_ID) Q8BVZ5 (S109-I266) (Accession)

Molecular Weight

Approximately 17-22 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Liew FY, et al. Interleukin-33 in health and disease. Nat Rev Immunol. 2016 Nov;16 (11) :676-689.|[2]Cayrol C, et al. Interleukin-33 (IL-33) : A nuclear cytokine from the IL-1 family. Immunol Rev. 2018 Jan;281 (1) :154-168.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to FITC,  40nm
GM-502-40 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to FITC, 40nm

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB633145 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
SEC61B Recombinant Rabbit monoclonal Antibody
HA751295 100 µL

SEC61B Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Retinoic Acid Receptor gamma (RARG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G1]
TA810381AM 100 µL

Retinoic Acid Receptor gamma (RARG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G1]

Sign In for Pricing
View Details
HYCC2 Antibody
KC-30870-01 50 μL

HYCC2 Antibody

Sign In for Pricing
View Details
HYCC2 Antibody
KC-30870-02 100 µL

HYCC2 Antibody

Sign In for Pricing
View Details