Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Mouse

IL-33 Protein, Mouse is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation.

Product Specifications

Product Name Alternative

IL-33 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-mouse.html

Purity

98.0

Smiles

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Molecular Formula

77125 (Gene_ID) Q8BVZ5 (S109-I266) (Accession)

Molecular Weight

Approximately 17-22 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Liew FY, et al. Interleukin-33 in health and disease. Nat Rev Immunol. 2016 Nov;16 (11) :676-689.|[2]Cayrol C, et al. Interleukin-33 (IL-33) : A nuclear cytokine from the IL-1 family. Immunol Rev. 2018 Jan;281 (1) :154-168.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E1]
TA501280BM 100 µL

FHL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E1]

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF488A conjugate, 0.1mg/mL
BNC882809-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM49C (NM_001195234) Human Over-expression Lysate
LY433834 100 µg

TRIM49C (NM_001195234) Human Over-expression Lysate

Sign In for Pricing
View Details
Murine IL-2 ELISA Kit, 1 x 48-well (pre-coated)
EA101684 1x 48 Well (Pre-Coated)

Murine IL-2 ELISA Kit, 1 x 48-well (pre-coated)

Sign In for Pricing
View Details
Glutathione Peroxidase 1 (GPX1) Human Knockdown Lysate
LY300348 100 µg

Glutathione Peroxidase 1 (GPX1) Human Knockdown Lysate

Sign In for Pricing
View Details
Deoxyribonuclease I like 1 (DNASE1L1) Rabbit Polyclonal Antibody
TA365782 100 µL

Deoxyribonuclease I like 1 (DNASE1L1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details