Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Mouse

IL-33 Protein, Mouse is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation.

Product Specifications

Product Name Alternative

IL-33 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-mouse.html

Purity

98.0

Smiles

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Molecular Formula

77125 (Gene_ID) Q8BVZ5 (S109-I266) (Accession)

Molecular Weight

Approximately 17-22 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Liew FY, et al. Interleukin-33 in health and disease. Nat Rev Immunol. 2016 Nov;16 (11) :676-689.|[2]Cayrol C, et al. Interleukin-33 (IL-33) : A nuclear cytokine from the IL-1 family. Immunol Rev. 2018 Jan;281 (1) :154-168.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cloticasone
TRC-C369760-250MG 250 mg

Cloticasone

Sign In for Pricing
View Details
PRLHR Antibody
8G728-AAT 50 µg

PRLHR Antibody

Sign In for Pricing
View Details
CD134, Mouse (OX40) (OX-86), Biotin conjugate, 0.1mg/mL
BNCB2004-500 1x 500 µL

CD134, Mouse (OX40) (OX-86), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6(beta)-Hydroxy-gestodene
TRC-H942525-5MG 5 mg

6(beta)-Hydroxy-gestodene

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF594 conjugate, 0.1mg/mL
BNC942939-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Diethyl 2-n-Butylmalonate
TRC-D443880-50G 50 g

Diethyl 2-n-Butylmalonate

Sign In for Pricing
View Details