Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Mouse

IL-33 Protein, Mouse is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation.

Product Specifications

Product Name Alternative

IL-33 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-mouse.html

Purity

98.0

Smiles

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Molecular Formula

77125 (Gene_ID) Q8BVZ5 (S109-I266) (Accession)

Molecular Weight

Approximately 17-22 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Liew FY, et al. Interleukin-33 in health and disease. Nat Rev Immunol. 2016 Nov;16 (11) :676-689.|[2]Cayrol C, et al. Interleukin-33 (IL-33) : A nuclear cytokine from the IL-1 family. Immunol Rev. 2018 Jan;281 (1) :154-168.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: LBI11G3]
AMM17181VCF 100 µg

Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: LBI11G3]

Sign In for Pricing
View Details
FAM198A siRNA (Mouse)
orb1835518-01 15 nmol

FAM198A siRNA (Mouse)

Sign In for Pricing
View Details
FAM198A siRNA (Mouse)
orb1835518-02 30 nmol

FAM198A siRNA (Mouse)

Sign In for Pricing
View Details
IL-33 Recombinant Protein
40-429-0002mg 0.002 mg

IL-33 Recombinant Protein

Sign In for Pricing
View Details
ALDH3B1
CSB-CL001574HU3 10 μg Plasmid + 200 μL Glycerol

ALDH3B1

Sign In for Pricing
View Details
PCGF1 3'UTR GFP Stable Cell Line
TU067552 1.0 mL

PCGF1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details