Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (swine) (TFA)

Galanin (swine) TFA, a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) TFA is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Metabolism-protein/nucleotide metabolism

Field of Research

Metabolic Disease

Assay Protocol

https://www.medchemexpress.com/galanin-swine-tfa.html

Solubility

10 mM in DMSO

Smiles

[GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2(TFAsalt)]

Molecular Formula

C148H214F3N43O42

Molecular Weight

3324.54

References & Citations

[1]Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21 (3) :109-117. |[2]Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229 (2) :233-237.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 (di methyl K4) Rabbit Monoclonal Antibody [KD Validation]
E51K1770 40 µL

Histone H3 (di methyl K4) Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Rebeads® cfDNA Special E
NBF209-01 50 mL

Rebeads® cfDNA Special E

Sign In for Pricing
View Details
Rebeads® cfDNA Special E
NBF209-02 100 mL

Rebeads® cfDNA Special E

Sign In for Pricing
View Details
Rebeads® cfDNA Special E
NBF209-03 500 mL

Rebeads® cfDNA Special E

Sign In for Pricing
View Details
Human FABP2/I-FABP MAb (Clone 323730)
MAB30781-500 500 µg

Human FABP2/I-FABP MAb (Clone 323730)

Sign In for Pricing
View Details
Rabbit Monoclonal KLC1 Antibody (SR2098)
NBP3-22348-100ul 100 µL

Rabbit Monoclonal KLC1 Antibody (SR2098)

Sign In for Pricing
View Details