Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (swine) (TFA)

Galanin (swine) TFA, a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) TFA is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Metabolism-protein/nucleotide metabolism

Field of Research

Metabolic Disease

Assay Protocol

https://www.medchemexpress.com/galanin-swine-tfa.html

Solubility

10 mM in DMSO

Smiles

[GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2(TFAsalt)]

Molecular Formula

C148H214F3N43O42

Molecular Weight

3324.54

References & Citations

[1]Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21 (3) :109-117. |[2]Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229 (2) :233-237.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-3163 miRNA Antagomir
MNH01797 2x 5.0 nmol

hsa-miR-3163 miRNA Antagomir

Sign In for Pricing
View Details
Recombinant Rat PHB Protein, N-His
RW829012-01 50 µg

Recombinant Rat PHB Protein, N-His

Sign In for Pricing
View Details
Recombinant Rat PHB Protein, N-His
RW829012-02 100 µg

Recombinant Rat PHB Protein, N-His

Sign In for Pricing
View Details
Recombinant Rat PHB Protein, N-His
RW829012-03 1 mg

Recombinant Rat PHB Protein, N-His

Sign In for Pricing
View Details
Ifitm3 (NM_025378) Mouse Tagged ORF Clone Lentiviral Particle
MR200854L4V 200 µL

Ifitm3 (NM_025378) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mcl-1 inhibitor 20
HY-159588 1 Each

Mcl-1 inhibitor 20

Sign In for Pricing
View Details