Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (swine) (TFA)

Galanin (swine) TFA, a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) TFA is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Metabolism-protein/nucleotide metabolism

Field of Research

Metabolic Disease

Assay Protocol

https://www.medchemexpress.com/galanin-swine-tfa.html

Solubility

10 mM in DMSO

Smiles

[GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2(TFAsalt)]

Molecular Formula

C148H214F3N43O42

Molecular Weight

3324.54

References & Citations

[1]Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21 (3) :109-117. |[2]Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229 (2) :233-237.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Bone Marrow Mononuclear Cell Isolation Solution Kit
P5160 200 mL/Kit

Monkey Bone Marrow Mononuclear Cell Isolation Solution Kit

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans cmk-1 Polyclonal Antibody
MBS9011576 Inquire

Rabbit anti-Caenorhabditis elegans cmk-1 Polyclonal Antibody

Sign In for Pricing
View Details
Complement factor D-IN-1 50mg
A20253-50 50 mg

Complement factor D-IN-1 50mg

Sign In for Pricing
View Details
Clec4d Rat siRNA Oligo Duplex (Locus ID 362432)
SR504226 1 Kit

Clec4d Rat siRNA Oligo Duplex (Locus ID 362432)

Sign In for Pricing
View Details
HBL-100 Cell Line
CL-0091 1x 10^6 Cells/Vial

HBL-100 Cell Line

Sign In for Pricing
View Details
MRGX1 Antibody
R32283 100 µg

MRGX1 Antibody

Sign In for Pricing
View Details