Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (swine) (TFA)

Galanin (swine) TFA, a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) TFA is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Metabolism-protein/nucleotide metabolism

Field of Research

Metabolic Disease

Assay Protocol

https://www.medchemexpress.com/galanin-swine-tfa.html

Solubility

10 mM in DMSO

Smiles

[GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2(TFAsalt)]

Molecular Formula

C148H214F3N43O42

Molecular Weight

3324.54

References & Citations

[1]Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21 (3) :109-117. |[2]Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229 (2) :233-237.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 Family 2 Subfamily R Member 1 (CYP2R1) Antibody
abx033747-01 80 µL

Cytochrome P450 Family 2 Subfamily R Member 1 (CYP2R1) Antibody

Sign In for Pricing
View Details
Cytochrome P450 Family 2 Subfamily R Member 1 (CYP2R1) Antibody
abx033747-02 400 µL

Cytochrome P450 Family 2 Subfamily R Member 1 (CYP2R1) Antibody

Sign In for Pricing
View Details
Donkey Serotonin N-Acetyltransferase (AANAT) ELISA Kit
MBS9936395 Inquire

Donkey Serotonin N-Acetyltransferase (AANAT) ELISA Kit

Sign In for Pricing
View Details
CLK1 Blocking Peptide
CBP3858-01 1 mg

CLK1 Blocking Peptide

Sign In for Pricing
View Details
CLK1 Blocking Peptide
CBP3858-02 5 mg

CLK1 Blocking Peptide

Sign In for Pricing
View Details
Heparanase (HPA)
140658 200 µL

Heparanase (HPA)

Sign In for Pricing
View Details