Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (swine) (TFA)

Galanin (swine) TFA, a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) TFA is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Metabolism-protein/nucleotide metabolism

Field of Research

Metabolic Disease

Assay Protocol

https://www.medchemexpress.com/galanin-swine-tfa.html

Solubility

10 mM in DMSO

Smiles

[GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2(TFAsalt)]

Molecular Formula

C148H214F3N43O42

Molecular Weight

3324.54

References & Citations

[1]Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21 (3) :109-117. |[2]Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229 (2) :233-237.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRS-1 (phospho-Ser612) Rabbit Polyclonal Antibody
E28PP1369 100 µL

IRS-1 (phospho-Ser612) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDCP1 (NM_178181) Human Over-expression Lysate
LC406018 20 µg

CDCP1 (NM_178181) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse EP300 (E1A Binding Protein P300) ELISA Kit
EK246287 96 Well

Mouse EP300 (E1A Binding Protein P300) ELISA Kit

Sign In for Pricing
View Details
RGD1560987 3'UTR Luciferase Stable Cell Line
TU218313 1.0 mL

RGD1560987 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
EMP1, NT (EMP1, B4B, TMP, Epithelial membrane protein 1, CL-20, Protein B4B, Tumor-associated membrane protein) (MaxLight 490)
MBS6295485-01 0.1 mL

EMP1, NT (EMP1, B4B, TMP, Epithelial membrane protein 1, CL-20, Protein B4B, Tumor-associated membrane protein) (MaxLight 490)

Sign In for Pricing
View Details
EMP1, NT (EMP1, B4B, TMP, Epithelial membrane protein 1, CL-20, Protein B4B, Tumor-associated membrane protein) (MaxLight 490)
MBS6295485-02 5x 0.1 mL

EMP1, NT (EMP1, B4B, TMP, Epithelial membrane protein 1, CL-20, Protein B4B, Tumor-associated membrane protein) (MaxLight 490)

Sign In for Pricing
View Details