Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (swine) (TFA)

Galanin (swine) TFA, a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) TFA is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Metabolism-protein/nucleotide metabolism

Field of Research

Metabolic Disease

Assay Protocol

https://www.medchemexpress.com/galanin-swine-tfa.html

Solubility

10 mM in DMSO

Smiles

[GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2(TFAsalt)]

Molecular Formula

C148H214F3N43O42

Molecular Weight

3324.54

References & Citations

[1]Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21 (3) :109-117. |[2]Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229 (2) :233-237.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

NECAB1 Mouse Monoclonal Antibody [Clone ID: OTI1H5]
CF502520 100 µg

NECAB1 Mouse Monoclonal Antibody [Clone ID: OTI1H5]

Sign In for Pricing
View Details
POU6F2-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV741217 1.0 µg DNA

POU6F2-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Human Thyroid Fibroblasts
ARP0036 0.5 Million

Human Thyroid Fibroblasts

Sign In for Pricing
View Details
Human WNT Inhibitory Factor 1 (WIF1) ELISA Kit
SL2913Hu-01 48 Tests

Human WNT Inhibitory Factor 1 (WIF1) ELISA Kit

Sign In for Pricing
View Details
Human WNT Inhibitory Factor 1 (WIF1) ELISA Kit
SL2913Hu-02 96 Tests

Human WNT Inhibitory Factor 1 (WIF1) ELISA Kit

Sign In for Pricing
View Details
Zinc finger protein 208 (ZNF208) Human ELISA Kit
I3362 96 Tests

Zinc finger protein 208 (ZNF208) Human ELISA Kit

Sign In for Pricing
View Details