TWEAK/TNFSF12, Human/Cynomolgus (HEK293, mFc)

TWEAK Protein refers to the cytokine tumor necrosis factor-like weak inducer of apoptosis, belongs to tumor necrosis factor (TNF) superfamily. TWEAK protein binds to FN14 and TNRFSF12/APO3, is a weak inducer of apoptosis[1]. TWEAK does have pro-apoptotic activity for tumor cell, mediates NF-kappa-B activation, promotes angiogenesis and the proliferation of endothelial cells (ECs) [2]. TWEAK also increases IL-6 and IL-8 secretion, and could potentiate the pro-inflammatory activities of TNF and IL-1[3].TWEAK/TNFSF12 Protein, Human/Cynomolgus (HEK293, mFc) is the extracellular part (S97-H249) of TWEAK protein, produced by HEK293 cells with N-terminal mFc-tag.

Product Specifications

Product Name Alternative

TWEAK/TNFSF12 Protein, Human/Cynomolgus (HEK293, mFc), Human; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tweak-tnfsf12-protein-human-cynomolgus-hek293-fc.html

Purity

95.00

Smiles

SAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Molecular Formula

8742/407977 (Gene_ID) NP_003800.1 (S94-H249) /F7HGN4 (S201-H356) (Accession)

Molecular Weight

Approximately 34 kDa & 47 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[2]Lammens A, et al. Crystal structure of human TWEAK in complex with the Fab fragment of a neutralizing antibody reveals insights into receptor binding. PLoS One. 2013 May 8;8 (5) :e62697.|[3]Lynch CN, et al. TWEAK induces angiogenesis and proliferation of endothelial cells. J Biol Chem. 1999 Mar 26;274 (13) :8455-9.|[4]Lynch CN, et al. TWEAK induces angiogenesis and proliferation of endothelial cells. J Biol Chem. 1999 Mar 26;274 (13) :8455-9.|[1]Wiley SR, et al. TWEAK, a member of the TNF superfamily, is a multifunctional cytokine that binds the TweakR/Fn14 receptor. Cytokine Growth Factor Rev. 2003 Jun-Aug;14 (3-4) :241-9.