Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGCP, Mouse (HEK293, His)

PGCP is a carboxypeptidase with a potentially critical role in the hydrolysis of circulating peptides. It catalyzes the cleavage of terminally unsubstituted dipeptides, releasing amino acids. PGCP Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGCP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PGCP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pgcp-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

KAVFKNGVSQRTFREIKEEIANYEDVAKAIINLAVYGKYQNRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWERGEESAVMLEPRIHKMAILGLGSSIGTPPGGITAEVLVVASFDELQRRASEARGKIIVYNQPYTGYEKTVQYRVQGAVEAAKVGAVASLIQSVASFSIYSPHTGIQKYQDGVPKIPTACITVEDAEMMSRMASRGNKIVIHLEMGAKTYPDTDSFNTVAEITGSMYPEEVVLVSGHLDSWDVGQGALDDGGGAFISWEALSLVKDLGLRPKRTLRLVLWTAEEQGGIGASQYYELHKANISKYSLVMEADSGTFLPTGLQFTGSDKARAIMKEVMNLLQPLNVTKVFSNGEGTDINFWIQAGVPGASLRDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVAYVVADMDEMLPRS

Molecular Formula

54381 (Gene_ID) Q9WVJ3 (K19-S470) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRED2 Antibody
KC-13392-01 50 μL

SPRED2 Antibody

Sign In for Pricing
View Details
SPRED2 Antibody
KC-13392-02 100 µL

SPRED2 Antibody

Sign In for Pricing
View Details
SPRED2 Antibody
KC-13392-03 1 mL

SPRED2 Antibody

Sign In for Pricing
View Details
Phosphoric Acid Silver Salt
TRC-P359210-50G 50 g

Phosphoric Acid Silver Salt

Sign In for Pricing
View Details
Digitoxigenin-21,23,23-d3
TRC-D445541-5MG 5 mg

Digitoxigenin-21,23,23-d3

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS500863 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details