Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGCP, Mouse (HEK293, His)

PGCP is a carboxypeptidase with a potentially critical role in the hydrolysis of circulating peptides. It catalyzes the cleavage of terminally unsubstituted dipeptides, releasing amino acids. PGCP Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGCP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PGCP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pgcp-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

KAVFKNGVSQRTFREIKEEIANYEDVAKAIINLAVYGKYQNRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWERGEESAVMLEPRIHKMAILGLGSSIGTPPGGITAEVLVVASFDELQRRASEARGKIIVYNQPYTGYEKTVQYRVQGAVEAAKVGAVASLIQSVASFSIYSPHTGIQKYQDGVPKIPTACITVEDAEMMSRMASRGNKIVIHLEMGAKTYPDTDSFNTVAEITGSMYPEEVVLVSGHLDSWDVGQGALDDGGGAFISWEALSLVKDLGLRPKRTLRLVLWTAEEQGGIGASQYYELHKANISKYSLVMEADSGTFLPTGLQFTGSDKARAIMKEVMNLLQPLNVTKVFSNGEGTDINFWIQAGVPGASLRDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVAYVVADMDEMLPRS

Molecular Formula

54381 (Gene_ID) Q9WVJ3 (K19-S470) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ABCA5 qPCR Primer Pair
QH35789S 200 Tests

Human ABCA5 qPCR Primer Pair

Sign In for Pricing
View Details
CDHR3 (Cadherin-related Family Member 3, Cadherin-like Protein 28, CDH28, FLJ23834, FLJ43271, FLJ44366, MGC133292, MGC133293) (MaxLight 490)
126869-ML490 100 µL

CDHR3 (Cadherin-related Family Member 3, Cadherin-like Protein 28, CDH28, FLJ23834, FLJ43271, FLJ44366, MGC133292, MGC133293) (MaxLight 490)

Sign In for Pricing
View Details
Interference Model
1110485 1 Each

Interference Model

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida proQ Protein (aa 1-210)
VAng-Cr7217-50gEcoli 50 µg (E. coli)

Recombinant Pasteurella Multocida proQ Protein (aa 1-210)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Barrier-to-autointegration factor-like protein (banf2)
MBS1373085-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis Barrier-to-autointegration factor-like protein (banf2)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Barrier-to-autointegration factor-like protein (banf2)
MBS1373085-02 0.1 mg (E-Coli)

Recombinant Xenopus laevis Barrier-to-autointegration factor-like protein (banf2)

Sign In for Pricing
View Details